PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA34355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YC
Protein Properties Length: 249aa    MW: 27169.9 Da    PI: 4.8284
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA34355genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC114.64.8e-3610918818100
                      NF-YC  18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprde 100
                                ++ lPlarikki+kadedv+m+s +aPv+l+kace+fi elt+rs +h+   k rtl+k+diaaav++t++fdflvdivp+++
  Tp57577_TGAC_v2_mRNA34355 109 KNCLPLARIKKIMKADEDVRMVSDDAPVILAKACEMFISELTMRSRNHS---KTRTLQKNDIAAAVAETNTFDFLVDIVPHEK 188
                                5679*****************************************9985...679*************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471135.87E-23110195IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.1E-29112185IPR009072Histone-fold
PfamPF008082.5E-17112171IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MTGAPAPVVT SLGGMQSTGQ PAGTQLGQHQ LAYQQQQLPG FWAYQMTGAP RSAVTSVGGI  60
QPTGQLVGAQ LGQHQLAYQH IQQQQQLQQQ LQAXXXXXXX XXXXXXXXKN CLPLARIKKI  120
MKADEDVRMV SDDAPVILAK ACEMFISELT MRSRNHSKTR TLQKNDIAAA VAETNTFDFL  180
VDIVPHEKMT DYPPAFQFPR NFSNEGGCQT VNPEGPLLPS ETIGNSLPVS PAFQIIEADE  240
DINEENSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C7e-2711218542118HapE
4g92_C7e-2711218542118HapE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1502443e-33AC150244.2 Medicago truncatula chromosome 7 clone mth2-180p14, complete sequence.
GenBankJQ9182943e-33JQ918294.1 Medicago truncatula nuclear transcription factor Y subunit C2 (NF-YC2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626304.15e-51nuclear transcription factor Y protein
TrEMBLQ2HTM12e-51Q2HTM1_MEDTR; Histone-fold/TFIID-TAF/NF-Y
STRINGGLYMA03G39911.15e-46(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54830.34e-37nuclear factor Y, subunit C3